General Information

  • ID:  hor003898
  • Uniprot ID:  P06297
  • Protein name:  Corticotropin-like intermediary peptide
  • Gene name:  pomc
  • Organism:  Oryctolagus cuniculus (Rabbit)
  • Family:  POMC family
  • Source:  animal
  • Expression:  Expressed in the pituitary gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oryctolagus (genus), Leporidae (family), Lagomorpha (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  PVKVYPNGAENESAEAFPVEV
  • Length:  21
  • Propeptide:  SYSMEHFRWGKPVGKKRRPVKVYPNGAENESAEAFPVEV
  • Signal peptide:  NA
  • Modification:  T13 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Precursor protein for pituitary hormones that regulate stress and environmental adaptation.; [Corticotropin]: Stimulates the adrenal glands to release cortisol.; [Melanocyte-stimulating hormone alpha]: Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  MC4R, MC3R
  • Target Unid:  G1TZU3, G1TLF3
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P06297-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor003898_AF2.pdbhor003898_ESM.pdb

Physical Information

Mass: 260336 Formula: C101H152N24O34
Absent amino acids: CDHILMQRTW Common amino acids: EV
pI: 3.82 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 8
Hydrophobicity: -34.29 Boman Index: -2410
Half-Life: >20 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: ? Aliphatic Index 69.52
Instability Index: 3188.1 Extinction Coefficient cystines: 1490
Absorbance 280nm: 74.5

Literature

  • PubMed ID:  3013598
  • Title:  Isolation, characterization, and corticotropic activity of rabbit adrenocorticotropin.